-
N/A
-
Daily visitors
N/A
-
Daily pageviews
N/A
Hosted with the same provider
Websites to check
Simplelifestyle.elitemarketingpro.com: Elite Marketing Pro | Welcome Online
Sign InSupportCareersFINALLY!A Simple Way To Recruit People Into Your Network Marketing Business Online -Rejection FREE- Without Wasting Your Time & Money Chasing Dead Beat Prospects &...
Simplelifestyle.elitemarketingpro.com: visit the most interesting Simplelifestyle Elite Marketing Pro pages, well-liked by users from USA, or check the rest of simplelifestyle.elitemarketingpro.com data below. Simplelifestyle.elitemarketingpro.com is a web project, safe and generally suitable for all ages. We found that English is the preferred language on Simplelifestyle Elite Marketing Pro pages. Simplelifestyle.elitemarketingpro.com uses Nginx for server.
Language: | English |
Last check |
simplelifestyle.elitemarketingpro.com most visited pages
-
I Leveled The Playing Field And Removed Every Roadblock To Helping You Make Maximum Profits In Minimum Time...
-
Headline Formulas" 5 Proven Ways You Can Instantly Grab Your Prospect's Attention And Pull Them Into Reading Your Sales Letter Or Watching Your Video. CLICK THE "DOWNLOAD NOW" BUTTON FOR INST...
-
Create Traffic Exploding And Money Making Blog Posts...YOURS FREE
This is a FREE service from Elite Marketing Pro. Credit card NOT required. Your Information is 100% Secure With Us And Will Never Be Shared With Anyone. Copyright © 2016 Elite Marketing Pro LLC • A...
Social media reactions
SERVER network INFO
simplelifestyle.elitemarketingpro.com
152.44.44.89 | |
Hosting provider: |
UpCloud USA San Jose |
DOMAIN
Registrar: | NameCheap, Inc. |
Registrant: | Redacted for Privacy Purposes |
Updated: | December 13, 2023 |
Expires: | January 12, 2025 |
Created: | January 12, 2010 |
simplelifestyle.elitemarketingpro.com is built with
Server: | Nginx |