-
N/A
-
Daily visitors
N/A
-
Daily pageviews
N/A
Hosted with the same provider
Websites to check
Simplelifestyle.elitemarketingpro.com: Elite Marketing Pro | Welcome Online
Sign InSupportCareersFINALLY!A Simple Way To Recruit People Into Your Network Marketing Business Online -Rejection FREE- Without Wasting Your Time & Money Chasing Dead Beat Prospects &...
Simplelifestyle.elitemarketingpro.com: visit the most interesting Simplelifestyle Elite Marketing Pro pages, well-liked by users from USA, or check the rest of simplelifestyle.elitemarketingpro.com data below. Simplelifestyle.elitemarketingpro.com is a web project, safe and generally suitable for all ages. We found that English is the preferred language on Simplelifestyle Elite Marketing Pro pages. Simplelifestyle.elitemarketingpro.com uses Nginx for server.
Language: | English |
Last check |
simplelifestyle.elitemarketingpro.com most visited pages
-
Create Traffic Exploding And Money Making Blog Posts...YOURS FREE
This is a FREE service from Elite Marketing Pro. Credit card NOT required. Your Information is 100% Secure With Us And Will Never Be Shared With Anyone. Copyright © 2016 Elite Marketing Pro LLC • A...
-
I Leveled The Playing Field And Removed Every Roadblock To Helping You Make Maximum Profits In Minimum Time...
-
Headline Formulas" 5 Proven Ways You Can Instantly Grab Your Prospect's Attention And Pull Them Into Reading Your Sales Letter Or Watching Your Video. CLICK THE "DOWNLOAD NOW" BUTTON FOR INST...
Social media reactions
SERVER network INFO
simplelifestyle.elitemarketingpro.com
152.44.44.89 | |
Hosting provider: |
UpCloud USA San Jose |
DOMAIN
Registrar: | NameCheap, Inc. |
Registrant: | Redacted for Privacy Purposes |
Updated: | December 13, 2023 |
Expires: | January 12, 2025 |
Created: | January 12, 2010 |
simplelifestyle.elitemarketingpro.com is built with
Server: | Nginx |