-
N/A
-
Daily visitors
N/A
-
Daily pageviews
N/A
Hosted with the same provider
Websites to check
Recently Analyzed
Jenniferlickey.elitemarketingpro.com: Elite Marketing Pro | Welcome Online
Sign InSupportCareersFINALLY!A Simple Way To Recruit People Into Your Network Marketing Business Online -Rejection FREE- Without Wasting Your Time & Money Chasing Dead Beat Prospects &...
Jenniferlickey.elitemarketingpro.com: visit the most interesting Jenniferlickey Elite Marketing Pro pages, well-liked by users from USA, or check the rest of jenniferlickey.elitemarketingpro.com data below. Jenniferlickey.elitemarketingpro.com is a web project, safe and generally suitable for all ages. We found that English is the preferred language on Jenniferlickey Elite Marketing Pro pages. Their most used social media is Facebook with 100% of all user votes and reposts. Jenniferlickey.elitemarketingpro.com uses Nginx for server.
Language: | English |
Last check |
jenniferlickey.elitemarketingpro.com most visited pages
-
Elite Marketing Pro is a global community of over 50,000 active small business entrepreneurs, providing targeted education, training, and mentoring programs
Social media reactions
SERVER network INFO
jenniferlickey.elitemarketingpro.com
152.44.44.89 | |
Hosting provider: |
UpCloud USA San Jose |
DOMAIN
Registrar: | NameCheap, Inc. |
Registrant: | Redacted for Privacy Purposes |
Updated: | December 13, 2023 |
Expires: | January 12, 2025 |
Created: | January 12, 2010 |
jenniferlickey.elitemarketingpro.com is built with
Server: | Nginx |