-
N/A
-
Daily visitors
N/A
-
Daily pageviews
N/A
Hosted with the same provider
Websites to check
Animatedfilmreviews.filminspector.com: Animated Film Reviews Online
The bold new films taking over Hollywood..
Animatedfilmreviews.filminspector.com: visit the most interesting Animated Film Reviews Inspector pages, well-liked by users from USA, or check the rest of animatedfilmreviews.filminspector.com data below. Animatedfilmreviews.filminspector.com is a web project, safe and generally suitable for all ages. We found that English is the preferred language on Animated Film Reviews Inspector pages. Their most used social media is Google+ with about 92% of all user votes and reposts. Animatedfilmreviews.filminspector.com uses OpenGSE for server.
Language: | English |
Last check |
animatedfilmreviews.filminspector.com most visited pages
-
Animated Film Reviews: Beauty and the Beast (1991) - Disney's Animation Revival Begins
Review, pictures and synopsis of the Disney animated feature Film Beauty and the Beast
-
Animated Film Reviews
-
Animated Film Reviews: "Frozen" Hidden Treats
The Animators Had Some Fun with "Frozen" There are all sorts of hidden treats in " Frozen ." Let's take a look, one by one. We'll try t...
Social media reactions
SERVER network INFO
animatedfilmreviews.filminspector.com
18.213.98.197 | |
Hosting provider: |
Amazon Technologies Inc. |
DOMAIN
Registrar: | NameCheap, Inc. |
Registrant: | Redacted for Privacy (Privacy service provided by Withheld for Privacy ehf) |
Updated: | August 22, 2023 |
Expires: | October 08, 2032 |
Created: | October 08, 2013 |
animatedfilmreviews.filminspector.com is built with
Server: | OpenGSE |
Programming language: | Java |